SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329461|ref|NP_440189.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329461|ref|NP_440189.1|
Domain Number 1 Region: 140-359
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.19e-55
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000749
Further Details:      
 
Domain Number 2 Region: 445-590
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.96e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000866
Further Details:      
 
Domain Number 3 Region: 9-139
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.006
Further Details:      
 
Domain Number 4 Region: 360-436
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.13e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|16329461|ref|NP_440189.1|
Domain Number - Region: 596-634
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00834
Family PutA pre-N-terminal region-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329461|ref|NP_440189.1|
Sequence length 635
Comment sulfite reductase subunit beta [Synechocystis sp. PCC 6803]
Sequence
MVTTPTAAPRKPSKVEGIKERSNYLREPLATELLNDANYFTDDAVQILKFHGSYQQDNRD
NRVKGQEKDYQFMLRTRNPGGLIPAQLYTALDDLSKTHGNQTLRVTTRQGLQIHGIVKKD
LKMAIATVVNNLGSTLGACGDINRNVMAPAAPFRDKPEYGYAWDYANKVADLLSPQSGAY
YEIWLDGEKVISGEEAPEVKAARQKDLNGTNLNDPKEPIYGQQFMPRKFKISVTVPGDNS
IDVYTHDISLVVITDRHGELRGFNVLAGGGLGRTHNKEETFARAADPIGYVSKDDVYDLV
KAIVATQRDYGDRHNRRHARMKYLLADWGVEKFRKQVETYMGKPFQSFKPLPAWRYQDYL
GWHEQGDGKLFFGLSVENGRIKDEGDFQLKTALRKVVDQFQLPLRLTANHNILLYDINAQ
DKAAIEQIFQQHGVVTDPEAIDTLVRYSMACPALPTCGLAVTESERIMPSVNARLRDLLN
SLDLPNESIVTRMTGCPNGCARPYMAEIGFVGSAPNSYQVWLGGSPNQERLAAAYTEKMP
LEQLESLFEPLFVYFKQSRKGKESFGDFCHRVGFTALREFSHGYTAPAKGGKNRKNQRRV
SLSDEMYAQLKARSERDNCPMNQIVQQALTAYLGK
Download sequence
Identical sequences L8AG48 P72854
gi|16329461|ref|NP_440189.1| gi|16329461|ref|NP_440189.1| WP_010871499.1.11876 WP_010871499.1.1889 WP_010871499.1.18904 WP_010871499.1.33690 WP_010871499.1.35395 WP_010871499.1.47586 WP_010871499.1.99424 gi|383321202|ref|YP_005382055.1| 1148.slr0963 gi|383324372|ref|YP_005385225.1| gi|383490256|ref|YP_005407932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]