SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329465|ref|NP_440193.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329465|ref|NP_440193.1|
Domain Number 1 Region: 38-141
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.84e-28
Family Pentapeptide repeats 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329465|ref|NP_440193.1|
Sequence length 150
Comment hypothetical protein slr0967 [Synechocystis sp. PCC 6803]
Sequence
MMKTIKSPLIALGLIFASPLLWGGTAIAENANQVQQLLETNACMNCDLSGADLSGAHLIG
ADLRNANLSGTNLNEANLEGADLTGANLQNADLRGAMVTNATLNRANLTSANFAFAKLYD
VDVTGATVEGMNIQNAEIYNTGIGIGGGDD
Download sequence
Identical sequences L8AF28 P72857
gi|383321206|ref|YP_005382059.1| gi|16329465|ref|NP_440193.1| gi|383324376|ref|YP_005385229.1| WP_010871503.1.11876 WP_010871503.1.1889 WP_010871503.1.18904 WP_010871503.1.33690 WP_010871503.1.35395 WP_010871503.1.47586 WP_010871503.1.99424 1148.slr0967 gi|383490260|ref|YP_005407936.1| gi|16329465|ref|NP_440193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]