SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329572|ref|NP_440300.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329572|ref|NP_440300.1|
Domain Number 1 Region: 66-375
Classification Level Classification E-value
Superfamily DHH phosphoesterases 3.53e-45
Family Manganese-dependent inorganic pyrophosphatase (family II) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329572|ref|NP_440300.1|
Sequence length 417
Comment hypothetical protein sll0639 [Synechocystis sp. PCC 6803]
Sequence
MASVSSQPGNSPSLSVPESSIVSSPQQISAQRSIASADVVSPRIPAANTAQIIKLQHHLE
GHQGQRLILVIQDFPDPDALSSAWAFQLIAAQYEIQCDIVYAGTLSHQENIALVKLTGLP
AKRWGPQMLKDIDLSDYQGCVLVDSQGTNSQLMPLVQEANIPVVVIIDHHSPQDEVEAEG
AFVDIRPSSRSTATILTEYLQGGMLDFNSSNPTHVKCATALMHGLRSDTINLLQAQEAEF
MAAAYLSRIYDAQLLNAVLQSARSKRVMEVIERSLQNRVVQNNFSLAGVGYLRYEERDAI
PQAADFLVSEENVHTALVYGIVHDRANDIELVIGSLRTNKLTLDPDEFLKDSLGMDGTGR
YYGGGRDMAGGFEIPVGFLTGCNDQAEYTKLKWEVFDRQLKQKFFRLINPDHRVVHS
Download sequence
Identical sequences L8AGQ7 P72962
gi|16329572|ref|NP_440300.1| gi|16329572|ref|NP_440300.1| 1148.sll0639 WP_010871608.1.11876 WP_010871608.1.1889 WP_010871608.1.18904 WP_010871608.1.33690 WP_010871608.1.35395 WP_010871608.1.47586 WP_010871608.1.99424 gi|383490367|ref|YP_005408043.1| gi|383324483|ref|YP_005385336.1| gi|383321313|ref|YP_005382166.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]