SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329602|ref|NP_440330.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329602|ref|NP_440330.1|
Domain Number 1 Region: 157-424
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.16e-73
Family Extended AAA-ATPase domain 0.0000000304
Further Details:      
 
Domain Number 2 Region: 411-608
Classification Level Classification E-value
Superfamily FtsH protease domain-like 2.49e-73
Family FtsH protease domain-like 0.00000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329602|ref|NP_440330.1|
Sequence length 616
Comment cell division protein FtsH [Synechocystis sp. PCC 6803]
Sequence
MSKNNKKWRNAGLYALLLIVVLALASAFFDRPTQTRETLSYSDFVNRVEANQIERVNLSA
DRTQAQVPNPSGGPPYLVNLPNDPDLINILTQHNVDIAVQPQSDEGFWFRIASTLFLPIL
LLVGIFFLFRRAQSGPGSQAMNFGKSKARVQMEPQTQVTFGDVAGIEQAKLELTEVVDFL
KNADRFTELGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGAS
RVRDLFEQAKANAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLTEMDGFEGNTGI
IIVAATNRPDVLDSALMRPGRFDRQVVVDRPDYAGRREILNVHARGKTLSQDVDLDKIAR
RTPGFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLV
AYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAV
ALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQGGGVFLG
RDIASDRDFSDETAAAIDEEVSQLVDQAYQRAKQVLVENRGILDQLAEILVEKETVDSEE
LQTLLANNNAKLALLV
Download sequence
Identical sequences L8ADG5 P72991
gi|383490397|ref|YP_005408073.1| WP_010871638.1.11876 WP_010871638.1.1889 WP_010871638.1.18904 WP_010871638.1.33690 WP_010871638.1.35395 WP_010871638.1.47586 WP_010871638.1.99424 gi|383321343|ref|YP_005382196.1| gi|16329602|ref|NP_440330.1| gi|383324513|ref|YP_005385366.1| gi|16329602|ref|NP_440330.1| 1148.slr1604 SgR246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]