SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329605|ref|NP_440333.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329605|ref|NP_440333.1|
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily AbrB/MazE/MraZ-like 0.0000136
Family Kis/PemI addiction antidote 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329605|ref|NP_440333.1|
Sequence length 75
Comment virulence associated protein B [Synechocystis sp. PCC 6803]
Sequence
MNTAQISTDGTHQIVILPENFTIAGSEVYIKKIGSTIILIAKNNPWQSLIESLDQFSDDF
MKTREQPPLDIREEF
Download sequence
Identical sequences L8AGI3 P72994
gi|16329605|ref|NP_440333.1| gi|383321346|ref|YP_005382199.1| gi|383490400|ref|YP_005408076.1| gi|383324516|ref|YP_005385369.1| WP_010871641.1.11876 WP_010871641.1.1889 WP_010871641.1.18904 WP_010871641.1.33690 WP_010871641.1.35395 WP_010871641.1.47586 WP_010871641.1.99424 gi|16329605|ref|NP_440333.1| 1148.ssl2922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]