SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329666|ref|NP_440394.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329666|ref|NP_440394.1|
Domain Number 1 Region: 6-215
Classification Level Classification E-value
Superfamily Thymidylate synthase-complementing protein Thy1 5.75e-60
Family Thymidylate synthase-complementing protein Thy1 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329666|ref|NP_440394.1|
Sequence length 215
Comment FAD-dependent thymidylate synthase [Synechocystis sp. PCC 6803]
Sequence
MDVRFISLTKPEIVIDGEPLSPEGLIAYCARVSSPNQENPNYTKLLQFCIREGHWSIFEM
VDMTLEITTTRAIAPQILRHRSFSFQEFSLRYSCATEYECYEARRQDVKNRQNSLDDFDE
STKKWFNQAQAAVWEKSHQLYEEALAKGIAKECARSILPLNTVTRLYMKGSVRSWIHYFS
VRCDQATQKEHREIALAARKIFMKHFPTVAAALEW
Download sequence
Identical sequences L8AFL7 P73053
1148.sll1635 gi|383324577|ref|YP_005385430.1| gi|383490461|ref|YP_005408137.1| gi|16329666|ref|NP_440394.1| gi|16329666|ref|NP_440394.1| gi|383321407|ref|YP_005382260.1| WP_010871702.1.11876 WP_010871702.1.1889 WP_010871702.1.18904 WP_010871702.1.33690 WP_010871702.1.35395 WP_010871702.1.47586 WP_010871702.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]