SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329691|ref|NP_440419.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16329691|ref|NP_440419.1|
Domain Number - Region: 219-276
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0353
Family DNA repair protein MutS, domain III 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329691|ref|NP_440419.1|
Sequence length 300
Comment hypothetical protein slr2037 [Synechocystis sp. PCC 6803]
Sequence
MRFNDSELHQMQKSINLLQQTVQQGFDDVNHRLDKMSQQLGYICLVVQDSRAKQEKLAQA
IAHFYQSSLVREIADLQSELQTINRFPEQSPIGAIKAANRSRLFLSHEALKITPELEAEL
MLNSDIAIQGWAVATITEANLLMEIGHHQDAKDVLREEVVKFKQLSENWSKALLDDANDS
LNTSYRFLGKPFNEFILPERIERICQIHPKDFNLTPDQVRRIKSEIAVEFDMSYAPERYN
QAWINKQLAIAEYLDTLSELLARLDTLQNFAQLCQDRGVKSSRELLPGNDAEPGLYLLPG
Download sequence
Identical sequences P73074
gi|383324603|ref|YP_005385456.1| WP_010871728.1.11876 WP_010871728.1.1889 WP_010871728.1.18904 WP_010871728.1.33690 WP_010871728.1.35395 WP_010871728.1.47586 WP_010871728.1.99424 1148.slr2037 gi|383321433|ref|YP_005382286.1| gi|16329691|ref|NP_440419.1| gi|383490487|ref|YP_005408163.1| gi|16329691|ref|NP_440419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]