SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329766|ref|NP_440494.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329766|ref|NP_440494.1|
Domain Number 1 Region: 580-682
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000000000314
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0097
Further Details:      
 
Domain Number 2 Region: 515-577
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000284
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.002
Further Details:      
 
Domain Number 3 Region: 435-514
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000235
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329766|ref|NP_440494.1|
Sequence length 704
Comment hypothetical protein sll0985 [Synechocystis sp. PCC 6803]
Sequence
MIIFMKFYSLPIVITSLWNLFVVRVLPTNRKNYIFRHQRLNLSQLIALTLLTLLLSLGFA
QAQSAQTLLSQLPPQIDLVDPVKSDFPLQNKAFNLGFESDLSGRIGNLDYTTVRVDGEPI
FLIAVPTGNASKEGDSSLSPIVYRQQRIESKFKEIVQRGFDPETLNVASSILNGAIIIQI
SDDKNLRPQILRTITKADADLYALTPEDLASETVDQVRNALMRARRERQPEALRRQIKVA
LVIVTIVVTVSLVVLFIYRWLGHRIHLLKMAINCLVKAEEEDPNFDYNYIDASIFKNIAA
IPRYSFAFQILDRIAIFLYYLSAYSKTILFGNVGWGDSKKNPPLTFSLDNQKIFENILEL
FQGKDFYDFLKNRLKQVVFTRRILIFFLFIIWIRGSAFFLQVFPNTRRLGRQLSGTPISL
TLIWLSAIILIKISDFLIESFFHTIENDYAILQTAKYTRRKIRINTVSSAVRGINLVVCI
FTAFVFSLSLFDVPVATVLAGAGIIGFAVSFGSQNLIKDLIAGISNLMSDAFAINDFVLI
GEFEGVVEDTNLFVTRIRCPNGDLVTIPNGAIGTVCNQTKDWSRVDYSVMVAADADPKKA
IAVLQQVALGLYHDPWWHPKMLQAPELKGIEEVSHQGILIRIWLKTLPGEQWDVARELRL
RVKVAFESQEIAIGVPQQQLLMTGTGTSPLYGDEKERASKDGEK
Download sequence
Identical sequences P73148
1148.sll0985 WP_010871803.1.11876 WP_010871803.1.1889 WP_010871803.1.18904 WP_010871803.1.33690 WP_010871803.1.35395 WP_010871803.1.47586 WP_010871803.1.99424 gi|383324678|ref|YP_005385531.1| gi|16329766|ref|NP_440494.1| gi|16329766|ref|NP_440494.1| gi|383321508|ref|YP_005382361.1| gi|383490562|ref|YP_005408238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]