SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329776|ref|NP_440504.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329776|ref|NP_440504.1|
Domain Number 1 Region: 42-235
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.68e-18
Family Hypothetical protein TT1808 (TTHA1514) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329776|ref|NP_440504.1|
Sequence length 237
Comment hypothetical protein slr1378 [Synechocystis sp. PCC 6803]
Sequence
MGKSSHFPPDSAGESLDYKQSPLCGENQIIMVTPTLVKTIATAAPQTFDQFLKQCPEEGR
FEWVNGKIIEMVNTREHKLIAEFILFAFHDEIRRLSLNFDVTTQATIRTEIKTGGFHGRI
PDVSVIDRHVWRSDPGDYRALTEPVQLAVEVVSSNWETDYFDKLDEYQRLGIKEYWIVDY
LAIGSRDILGEPKQPTVSIYTLNPEGVYDRQAFQGQETLVSPTFAELVLTPEQIFNA
Download sequence
Identical sequences P73158
gi|16329776|ref|NP_440504.1| gi|16329776|ref|NP_440504.1| gi|383490572|ref|YP_005408248.1| gi|383321518|ref|YP_005382371.1| gi|383324688|ref|YP_005385541.1| WP_010871813.1.11876 WP_010871813.1.1889 WP_010871813.1.18904 WP_010871813.1.33690 WP_010871813.1.35395 WP_010871813.1.47586 WP_010871813.1.99424 1148.slr1378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]