SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329786|ref|NP_440514.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329786|ref|NP_440514.1|
Domain Number 1 Region: 57-203
Classification Level Classification E-value
Superfamily GAF domain-like 1.2e-21
Family GAF domain 0.01
Further Details:      
 
Domain Number 2 Region: 199-318
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000436
Family Heme-binding PAS domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329786|ref|NP_440514.1|
Sequence length 322
Comment hypothetical protein slr1385 [Synechocystis sp. PCC 6803]
Sequence
MSIYDPNPDQSLARIDALEKELANLKASHNTLDIQNKILKGFISLTNVSAGRMLIKATLQ
KTMEASIHQTGAQLGSLFLLDGDGRVTESILARGATDQSQKKNIVGQVLDKGLAGWVREN
KRTGLINDTTKDYRWLKLPDEPYQALSALGVPIVWGDELLGILTLMHSQVNHFTPACATA
MEKTAELIALVLNNARIQTKHKQNETLIQQEDDLLNQAILWFPSIIFILDNQGVLLKCGG
KYLAQIGLDPKESIGKSIYYLLPEANELKSLTSHALANNIIESVSVQMERVDHGTWFYDA
WFSPILDNHGQVSNVVCMLLPA
Download sequence
Identical sequences L8AE20 P73168
gi|16329786|ref|NP_440514.1| gi|383321528|ref|YP_005382381.1| gi|383490582|ref|YP_005408258.1| APC68178.0 WP_010871823.1.11876 WP_010871823.1.1889 WP_010871823.1.18904 WP_010871823.1.33690 WP_010871823.1.35395 WP_010871823.1.47586 WP_010871823.1.99424 1148.slr1385 gi|383324698|ref|YP_005385551.1| gi|16329786|ref|NP_440514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]