SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329802|ref|NP_440530.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329802|ref|NP_440530.1|
Domain Number 1 Region: 421-593
Classification Level Classification E-value
Superfamily GAF domain-like 3.34e-53
Family GAF domain 0.0018
Further Details:      
 
Domain Number 2 Region: 796-963
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.12e-46
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 3 Region: 229-398
Classification Level Classification E-value
Superfamily GAF domain-like 2.55e-34
Family GAF domain 0.0051
Further Details:      
 
Domain Number 4 Region: 711-808
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1e-17
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 
Domain Number 5 Region: 33-196
Classification Level Classification E-value
Superfamily GAF domain-like 1.04e-17
Family GAF domain 0.0056
Further Details:      
 
Domain Number 6 Region: 600-662
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000131
Family Heme-binding PAS domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329802|ref|NP_440530.1|
Sequence length 974
Comment sensory transduction histidine kinase [Synechocystis sp. PCC 6803]
Sequence
MVIIGLLLVKVYVNYCNTFLRNVTMSPSSHGTAVQQAIADQLLEMILQSQDLHNAYRLVV
EGLQRGLGVDRVLLVQNAVFPNRQSRLVAQAIAPARDIMLLDEPCADCRWLHLLGQLPHY
GLWTVWEGEGEFVQLDPVQGEFCRTLGIKSLLHLPLVINQRHWGVLSLQYLHQARPWPLE
DQQFAQRIAHLFCLGLMKTELWIHCQNHKNALQTVVAEGQVQRETYLKSAQRERAIADVI
DKIRFALDLRSLFQTTVTEVRKLLVADRVMIIKVRQNKNFSWGEIQAEAQTDDKLCLLPP
KERVPLSSRWIDHFAKGLILAMDDTDDQRADFDQSMLALAKANLVVPLFSGDRLWGVLSV
HQCDGPRVWESSDIEFALKIALNLGVALQQAELLTESQRRSTALQSALGEVEAQKDYLAR
IAEEERALTRVIEGIRQTLELQNIFRATSDEVRHLLSCDRVLVYRFNPDWSGEFIHESVA
QMWEPLKDLQNNFPLWQDTYLQENEGGRYRNHESLAVGDVETAGFTDCHLDNLRRFEIRA
FLTVPVFVGEQLWGLLGAYQNGAPRHWQAREIHLLHQIANQLGVAVYQAQLLARFQEQSK
TMENTLADLTAIVDNLADGLLVIDLFGRITRYNPALLAMFDLEGLELLGAGVDAYFPETL
NQLLAKPEREEQKLVTADVELSQGRQGQALITSITSHENGCEYPQCLGAVIMIRDVTHER
EVERMKTDFLATVSHELRTPLTSILGFATVIQDKLNRVIIPELDLAQPHLGKATERVMRN
LAIIESEAQRLTVLINDVLDIAKMEAGQESWQEQPCAIGPIIERAIATITPQAQKKNISL
QGDLEPGLPDFIGDENRILQVVLNLLSNAVKFTPKGLITARSHFHQNYLWVEIIDHGPGI
HPADQEKIFEPFQQGGGDVLTDKPQGTGLGLPICKKIVEHHGGTIGVNSSLGRGSTFYFS
LPVPVPAVETSPAV
Download sequence
Identical sequences P73184
1148.slr1393 gi|16329802|ref|NP_440530.1| gi|383321544|ref|YP_005382397.1| gi|383324714|ref|YP_005385567.1| WP_010871839.1.11876 WP_010871839.1.1889 WP_010871839.1.18904 WP_010871839.1.33690 WP_010871839.1.35395 WP_010871839.1.47586 WP_010871839.1.99424 gi|383490598|ref|YP_005408274.1| gi|16329802|ref|NP_440530.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]