SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329823|ref|NP_440551.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329823|ref|NP_440551.1|
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Globin-like 2.13e-86
Family Phycocyanin-like phycobilisome proteins 0.000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329823|ref|NP_440551.1|
Sequence length 162
Comment phycocyanin a subunit [Synechocystis sp. PCC 6803]
Sequence
MKTPLTEAVSTADSQGRFLSSTELQIAFGRLRQANAGLQAAKALTDNAQSLVNGAAQAVY
NKFPYTTQTQGNNFAADQRGKDKCARDIGYYLRIVTYCLVAGGTGPLDEYLIAGIDEINR
TFDLSPSWYVEALKYIKANHGLSGDARDEANSYLDYAINALS
Download sequence
Identical sequences L8AHV8 Q54715
WP_010871860.1.11876 WP_010871860.1.1889 WP_010871860.1.18904 WP_010871860.1.33690 WP_010871860.1.35395 WP_010871860.1.47586 WP_010871860.1.99424 gi|383490619|ref|YP_005408295.1| 000223329|e4f0tA1|106.1.1.4|A:1-162 cath|current|4f0tA00/1-174 d4f0ta_ gi|16329823|ref|NP_440551.1| 1148.sll1578 4f0t_A gi|383324735|ref|YP_005385588.1| gi|383321565|ref|YP_005382418.1| gi|16329823|ref|NP_440551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]