SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329824|ref|NP_440552.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329824|ref|NP_440552.1|
Domain Number 1 Region: 4-171
Classification Level Classification E-value
Superfamily Globin-like 2.18e-101
Family Phycocyanin-like phycobilisome proteins 0.000000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329824|ref|NP_440552.1|
Sequence length 172
Comment phycocyanin subunit B [Synechocystis sp. PCC 6803]
Sequence
MFDVFTRVVSQADARGEYLSGSQLDALSATVAEGNKRIDSVNRITGNASAIVSNAARALF
AEQPQLIQPGGNAYTSRRMAACLRDMEIILRYVTYATFTGDASVLEDRCLNGLRETYVAL
GVPGASVAAGVQKMKEAALDIVNDPNGITRGDCSAIVAEIAGYFDRAAAAVA
Download sequence
Identical sequences L8AHJ4 Q54714
4f0t_B gi|383321566|ref|YP_005382419.1| 000223330|e4f0tB1|106.1.1.4|B:1-172 d4f0tb_ gi|383324736|ref|YP_005385589.1| gi|16329824|ref|NP_440552.1| gi|383490620|ref|YP_005408296.1| WP_010871861.1.11876 WP_010871861.1.1889 WP_010871861.1.18904 WP_010871861.1.33690 WP_010871861.1.35395 WP_010871861.1.47586 WP_010871861.1.99424 1148.sll1577 gi|16329824|ref|NP_440552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]