SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329837|ref|NP_440565.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329837|ref|NP_440565.1|
Domain Number 1 Region: 355-377,408-747
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.54e-95
Family beta-Lactamase/D-ala carboxypeptidase 0.00062
Further Details:      
 
Domain Number 2 Region: 188-400
Classification Level Classification E-value
Superfamily Lysozyme-like 2.42e-66
Family PBP transglycosylase domain-like 0.000015
Further Details:      
 
Domain Number 3 Region: 46-147
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.13e-26
Family FHA domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329837|ref|NP_440565.1|
Sequence length 749
Comment penicillin-binding protein 1B [Synechocystis sp. PCC 6803]
Sequence
MATRSRKAPSAPKKSQTNLSQGGNSQKVALKKGSRVAKIRLQESGKNSQSRRVFPLLGDR
YFLGRSSSCDIQLQNPLVSQTHCSLRRDPDHPNQFFIRDEGSSNGIYLQRRRLKSYRLQH
GDEITLGPPELVDVPKLVYFNPPPLWLKGMRTFFSTGILFFLIITGAIAWQWSKIPVKPM
PSGVTGPVKVYAGDGVTEINPVKQEIHREFDNLSDFSPYLPQAVIASEDTRFYWHFGVDP
YGLGRAIYINLQDRDVKQGASTLTQQLARSLFSEVGRENTAGRKIREMFVALKLEAVYSK
DDILKAYLNRVYLGAGNYGFEDAAQFYFDKSAQDLDVGEAATLVAMLPAPNLYNPVQDYQ
TSVQLRNRVIERMAMLGMIDEQEANRARRSRIQVSPKATQTLSQRQAPYFYGYIFGELNH
LLGEDVAKEGNFVVETSLNLKMQALAEKSLQKFLTTEGKKYAVSQGAVVTLDSRTGAVLA
MVGGKSYRESQFNRASQAQRQPGSTFKLFAYTAAIAKGVSTNQAFECGPFTWQGQNYKPC
ERSGAAPAITFAEGFAQSENVVALRVAQTVGLDEIIALAKDFGVNSSLVKEPGLVLGQSE
ARVLEMTGAYGAIANGGVWNRPHGIVNIRDGGDCPDPEQLKSCREVYQVSQDGRGQKQVV
SPAIAATMTQLLQAAVTNGTGKAADIGYGTAGKTGTTDKAVDLWFIGFLPQKNLVTGIWL
GNDDSSPTQGSSGLAATLWGQYMRQIASL
Download sequence
Identical sequences L8AHX1 P73218
gi|383490632|ref|YP_005408308.1| gi|383324748|ref|YP_005385601.1| WP_010871874.1.11876 WP_010871874.1.1889 WP_010871874.1.18904 WP_010871874.1.33690 WP_010871874.1.35395 WP_010871874.1.47586 WP_010871874.1.99424 gi|16329837|ref|NP_440565.1| 1148.slr1710 gi|16329837|ref|NP_440565.1| gi|383321579|ref|YP_005382432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]