SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329858|ref|NP_440586.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329858|ref|NP_440586.1|
Domain Number 1 Region: 343-585
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.55e-93
Family ABC transporter ATPase domain-like 0.00000045
Further Details:      
 
Domain Number 2 Region: 11-331
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 3.66e-65
Family ABC transporter transmembrane region 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329858|ref|NP_440586.1|
Sequence length 593
Comment ABC transporter [Synechocystis sp. PCC 6803]
Sequence
MTKPIAPLLSLLNYSRVHRAKIYWAVTCSLLNKIFDLAPPALIGLAVDVVIKQQDSFLSR
WGIVSVQSQLLVLTVASAVIWALESIFEYAYERLWRNLAQDIQHDLRLDAYAHLQQLDLA
YFEERSTGRLMAILNDDINQLERFLDVGANEILQVLTTVVVIGGAFFVITPDIAWMAVVP
MPFVLLGSIYFQSLLTSRYALVREKVSNLNSRLSNNLSGIMTIKSFATEAEEVERLRQDS
DAYRDSNQRAIALSAAFVPLIRVIIFAGFSTILYFGGLDAVRGNLAVGSYSMLVFLTQRL
LWPLTGLGKTLDLYQRAMASTQRVMQLLATPIQAHPGELSLHPSQVQGELVFQNISFAYP
HRSAVLKNVSLRVPAGQTIGIVGATGSGKSTLVKLLLRLYEWDSGDILLDGVDLKKYFLG
DLRRSVGLVSQDVFLFHGTVRENIAYGSADATLAQIERAANLAEAEEFINQLPQGYDTII
GERGQKLSGGQRQRLAIARAILKNPPILILDEATSAVDNETEAAIVRSLEKITKNRTTIT
IAHRLSTVRYADQIYVLENGMVQEMGSHESLLAHQGLYAKLWRVQTGLRSGVS
Download sequence
Identical sequences P73239
gi|383490653|ref|YP_005408329.1| gi|383324769|ref|YP_005385622.1| gi|16329858|ref|NP_440586.1| gi|383321600|ref|YP_005382453.1| gi|16329858|ref|NP_440586.1| WP_010871895.1.11876 WP_010871895.1.1889 WP_010871895.1.18904 WP_010871895.1.33690 WP_010871895.1.35395 WP_010871895.1.47586 WP_010871895.1.99424 1148.slr2019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]