SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329859|ref|NP_440587.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329859|ref|NP_440587.1|
Domain Number 1 Region: 5-54
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000112
Family GSPII protein E N-terminal domain-like 0.034
Further Details:      
 
Domain Number 2 Region: 67-124
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000942
Family GSPII protein E N-terminal domain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329859|ref|NP_440587.1|
Sequence length 251
Comment hypothetical protein sll1921 [Synechocystis sp. PCC 6803]
Sequence
MAQSPCSRLLGEILREADLITEAQIQVALQDQQYSPLPIGEILVVRGWLHQETVDFFAES
WPRMVKTRDRRPLGYYLQQAYLLQEDQVNLILEEQRKLGVRFGSVAVLKGWVKQKTLDYF
LEHLMPEAITTSAFQGRNTQSNIAFVRDTRLQTETGYETKGMGDRRAPVNTPSRDRVTPS
RANDNGGRIILNPFASNSGNGKIRTGKTKSTQGSSSSTTNSNREDFDLASVLADGAKSTA
EKDWEERIWID
Download sequence
Identical sequences L8AE93 P73240
1148.sll1921 gi|16329859|ref|NP_440587.1| WP_010871896.1.11876 WP_010871896.1.1889 WP_010871896.1.18904 WP_010871896.1.33690 WP_010871896.1.35395 WP_010871896.1.47586 WP_010871896.1.99424 gi|16329859|ref|NP_440587.1| gi|383324770|ref|YP_005385623.1| gi|383321601|ref|YP_005382454.1| gi|383490654|ref|YP_005408330.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]