SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329874|ref|NP_440602.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329874|ref|NP_440602.1|
Domain Number 1 Region: 92-231
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.0000000000116
Family MoCo biosynthesis proteins 0.014
Further Details:      
 
Domain Number 2 Region: 8-85
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000407
Family PDZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329874|ref|NP_440602.1|
Sequence length 451
Comment hypothetical protein slr2030 [Synechocystis sp. PCC 6803]
Sequence
MSEVSLRPAKISTVLPGSLGEEMGFEPGDAIVRINGQAPRDLIDYQFLCADDYLELDVLD
SQGELHELAVEKEFDQDLGLGFETALFDGLIQCNNRCPFCFIDQQPPGKRESLYYKDDDY
RLSFLYGSYLTLTNLSAKEWQRIEQLRLSPLYVSIHATEASVRERLLKNHRAGQILDQLA
WFQARRLQIHAQVVVCPGVNDGKHLEQTLRDLAQFHQGETPAVISVAVVPVGLTRFRPQE
DELSPVGQAKATEVIAQVQALQKEFAQQLGGNFVWLADEWFLIARQPLPPESHYEDYPQI
GNGVGSIRQFIKEFQQQAAEFLPPAIAEAKTLTWVVGNAVEQAFELLVEQLNQVKGLTVN
LAPLNSDYWGQEITVTGLLTGQDLIAKLAGRDLGDGILLPALMLKHDDTRFLDDLRVADV
AQKLGTTIYPVADVASLLEHCVQPMAVSRHC
Download sequence
Identical sequences L8AEA4 P73255
gi|16329874|ref|NP_440602.1| gi|383490669|ref|YP_005408345.1| gi|383321616|ref|YP_005382469.1| gi|16329874|ref|NP_440602.1| 1148.slr2030 NYSGXRC-10151e WP_010871911.1.11876 WP_010871911.1.1889 WP_010871911.1.18904 WP_010871911.1.33690 WP_010871911.1.35395 WP_010871911.1.47586 WP_010871911.1.99424 gi|383324785|ref|YP_005385638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]