SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329889|ref|NP_440617.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16329889|ref|NP_440617.1|
Domain Number - Region: 73-100
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00636
Family Rubredoxin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329889|ref|NP_440617.1|
Sequence length 120
Comment hypothetical protein sll1078 [Synechocystis sp. PCC 6803]
Sequence
MHETDMTKALIMTIQDWFDQQVEKPQITKIHLLVGQFTCVEPVSLQFAFEVQTKQTFLNG
AELVIKDVPLVAYCHTCQTEYSPEIGLQYSCPTCRSPMDDIRSGRELKIDRIEHHQCTPA
Download sequence
Identical sequences L8AGB6 P73269
gi|16329889|ref|NP_440617.1| gi|383490684|ref|YP_005408360.1| gi|383324800|ref|YP_005385653.1| 1148.sll1078 WP_010871926.1.11876 WP_010871926.1.1889 WP_010871926.1.18904 WP_010871926.1.33690 WP_010871926.1.35395 WP_010871926.1.47586 WP_010871926.1.99424 gi|383321631|ref|YP_005382484.1| gi|16329889|ref|NP_440617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]