SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329894|ref|NP_440622.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329894|ref|NP_440622.1|
Domain Number 1 Region: 5-227,420-670
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.63e-145
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000000786
Further Details:      
 
Domain Number 2 Region: 227-419
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 5.76e-54
Family ValRS/IleRS/LeuRS editing domain 0.00000397
Further Details:      
 
Domain Number 3 Region: 666-868
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.49e-38
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329894|ref|NP_440622.1|
Sequence length 869
Comment leucyl-tRNA synthetase [Synechocystis sp. PCC 6803]
Sequence
MASPYNAGEIEQKWQQRWAEWGLDKTPIASDLPKFYALSMFPYPSGNLHMGHVRNYTITD
VIARLKRMQGYQVLHPMGWDAFGLPAENAAIERGIPPKQWTEKNIAQMRAQLQQLGLSID
WEREVATCAPDYYRWTQWLFLEFFQAGLAYQKEATVNWDPIDQTVLANEQVDSEGRSWRS
GAMVERKLLRQWFLKITDYAEALLNDLEQLTGWPERVKLMQSHWIGKSVGAYLEFPIKDS
QEKIAVFTTRPDTVYGVTYVVLAPEHPLTKVVTTAEQQGTVDEFVAMVAKESEIERTAED
KPKRGVKTGGIAINPFNGEEIPILIADYVLYEYGTGAVMGVPAHDQRDFKFAQDNNLPMQ
VVIIPDDADNSDVNLTVAYTEAGVMVNSAQFTGMASPKAKQAIIKFAEDNDYGRAKVQYR
LRDWLISRQRYWGCPIPIIHCDDCGAVPVPTKDLPVELPDNVEFSGRGPSPLAKLEDWIN
VPCPSCGKPARRETDTMDTFIDSSWYFLRYADAQNTELPFDGEKVAHWLPVDQYVGGIEH
AILHLLYSRFFTKVLADRQLIPVKEPFQKLLTQGMVQGITYKNPTTGKYVPAKDLQTGQQ
VIDPKDPKDPDSGEPLQVFYEKMSKSKFNGVDPQEVLAKYGADTARMFILFKAPPEKDLE
WDDADVEGQFRFLNRVWRLVTDYIGDPAGIRFAVRPETLVTNEPLTKAEKDLRRAIHGAI
KEVAEDLNDDYQFNTAISEMMKLSNALIAATDLISFPVYQEGIETLLLLLAPFAPHLTEE
LWHRLGRTDSIHQQAWLQVDPTALVLDEITLVIQVLGKTRGTITVPASADKTQLEELARN
SDLAQRYLEGKTIKKVIVVPGKLVNFVIT
Download sequence
Identical sequences P73274
1148.sll1074 gi|383324805|ref|YP_005385658.1| gi|383490689|ref|YP_005408365.1| WP_010871931.1.11876 WP_010871931.1.1889 WP_010871931.1.18904 WP_010871931.1.33690 WP_010871931.1.35395 WP_010871931.1.47586 WP_010871931.1.99424 gi|16329894|ref|NP_440622.1| gi|383321636|ref|YP_005382489.1| gi|16329894|ref|NP_440622.1| NYSGRC-FDAO-BAA17302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]