SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329898|ref|NP_440626.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329898|ref|NP_440626.1|
Domain Number 1 Region: 359-598
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.33e-85
Family ABC transporter ATPase domain-like 0.00000255
Further Details:      
 
Domain Number 2 Region: 19-340
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 4.71e-75
Family ABC transporter transmembrane region 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329898|ref|NP_440626.1|
Sequence length 601
Comment ABC transporter [Synechocystis sp. PCC 6803]
Sequence
MTPSPAAPPSDNDWRLLLRLLPYVKRYPKELAAALVLLIPVAFSGAVQPLIIGQAVSLLR
EEPAWGFLDAMPLDRALHTLVIILAVTIVIRLLFLGLQGFIVQKMGQEITADVRQDLFEH
VTSLSVNFFHRTPVGRLVTRITSDVEALGEVFASGAIGVVSDIVSILAIIVTIFWVQWQL
ALLLVGMLVPVTVLIIYFQQQYRKANYQAREELSRLNSQLQENVAGINVVQLFRREELNS
RSFRRVNEKYRRAVDKTIFHDSAVSATLEWISLVAIAGVLGLGGWLILRDNLEFGVLAAF
ILYGQRLFNPLRQFADKFTMFQSGFTAIERIGELMEEPVEIKDQAVITPIEINGALRGSH
GEICFENVWFGYKPDEYVLKNLNFTIKPGEKVALVGPTGAGKSSIIRLLCRLHDPSRGRI
LVDGIDIRELSQQQLRRFIGVILQDSFLFAGDVKRNITLGEEYSLEEVQRAAQLTSVDRL
IEELPQGYHTQLRERGSNLSGGQKQLLAFARVAIREPYVLVMDEATASLDVRTEADIQAA
LLHLLQDRTSIIIAHRLSTIRNVDRIFVLKHGEIVETGNHDQLLDLKGLYASLYQLQMLG
G
Download sequence
Identical sequences P73278
gi|383324810|ref|YP_005385663.1| gi|16329898|ref|NP_440626.1| 1148.slr1149 gi|16329898|ref|NP_440626.1| gi|383490694|ref|YP_005408370.1| gi|383321641|ref|YP_005382494.1| WP_010871936.1.11876 WP_010871936.1.1889 WP_010871936.1.18904 WP_010871936.1.33690 WP_010871936.1.35395 WP_010871936.1.47586 WP_010871936.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]