SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329912|ref|NP_440640.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329912|ref|NP_440640.1|
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily L28p-like 7.06e-25
Family Ribosomal protein L31p 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329912|ref|NP_440640.1|
Sequence length 81
Comment 50S ribosomal protein L31 [Synechocystis sp. PCC 6803]
Sequence
MPKADIHPTWYPDAKVTCNGEVIMTVGSTKPEINVEIWSGNHPFYTGTQKIIDTEGRVDR
FMRKYGMKEKTTGDKQDKKKK
Download sequence
Identical sequences P73292
1148.ssl3445 gi|16329912|ref|NP_440640.1| gi|16329912|ref|NP_440640.1| gi|383490708|ref|YP_005408384.1| WP_010871950.1.11876 WP_010871950.1.1889 WP_010871950.1.18904 WP_010871950.1.33690 WP_010871950.1.35395 WP_010871950.1.47586 WP_010871950.1.99424 gi|383324824|ref|YP_005385677.1| gi|383321655|ref|YP_005382508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]