SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329925|ref|NP_440653.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329925|ref|NP_440653.1|
Domain Number 1 Region: 86-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.56e-23
Family Translational machinery components 0.00045
Further Details:      
 
Domain Number 2 Region: 15-82
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.56e-19
Family Ribosomal S5 protein, N-terminal domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329925|ref|NP_440653.1|
Sequence length 173
Comment 30S ribosomal protein S5 [Synechocystis sp. PCC 6803]
Sequence
MAKRRKTSREKKEDTNWQERVIQIRRVSKVVKGGKKLSFRAIVVVGNETGQVGVGVGKAG
DVIGAVRKGVADGKKQLIEVPLTKSNSITHITNGVSGGAKVVVRPAAPGTGVIAGGAVRT
VLELAGVKNILAKQLGSNNPLNNARAAINALETLRTFSEVAEERGVSVEHLYT
Download sequence
Identical sequences A0A068MY90 L8AHS8 P73304
WP_010871963.1.11876 WP_010871963.1.1889 WP_010871963.1.18904 WP_010871963.1.33690 WP_010871963.1.35395 WP_010871963.1.47586 WP_010871963.1.709 WP_010871963.1.99424 gi|16329925|ref|NP_440653.1| gi|383321668|ref|YP_005382521.1| gi|383490721|ref|YP_005408397.1| 1148.sll1812 gi|16329925|ref|NP_440653.1| gi|383324837|ref|YP_005385690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]