SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329927|ref|NP_440655.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329927|ref|NP_440655.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.19e-36
Family Ribosomal protein L6 0.0000394
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 8.11e-24
Family Ribosomal protein L6 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329927|ref|NP_440655.1|
Sequence length 179
Comment 50S ribosomal protein L6 [Synechocystis sp. PCC 6803]
Sequence
MSRIGKRPIPLPAKVSVDIQGSHLSVKGPKGSLERQLPEKVIVAQEGETITVTRQDESRT
ARERHGLVRTLVANMVDGVAQGFERRLEIQGVGYRAQAQGNKLTLNVGYSKPVEMTMPQG
IEVKVENNTQVIVSGIDKELLGNTAAKIRAVRPPEPYKGKGIRYQGEYVRRKAGKTGKK
Download sequence
Identical sequences L8AGE8 P73306
gi|16329927|ref|NP_440655.1| gi|383324839|ref|YP_005385692.1| WP_010871965.1.11876 WP_010871965.1.1889 WP_010871965.1.18904 WP_010871965.1.33690 WP_010871965.1.35395 WP_010871965.1.47586 WP_010871965.1.99424 gi|383490723|ref|YP_005408399.1| gi|16329927|ref|NP_440655.1| gi|383321670|ref|YP_005382523.1| 1148.sll1810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]