SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329935|ref|NP_440663.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329935|ref|NP_440663.1|
Domain Number 1 Region: 110-208
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 2.75e-39
Family Ribosomal protein S3 C-terminal domain 0.0000173
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 7.59e-38
Family Prokaryotic type KH domain (KH-domain type II) 0.000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329935|ref|NP_440663.1|
Sequence length 240
Comment 30S ribosomal protein S3 [Synechocystis sp. PCC 6803]
Sequence
MGQKIHPVGFRLGITKDHKSCWYADPKRYPELLQEDHKIRQYIEKTLNNAGISDIRIERK
AEQIELGIHTARPGVVVGRGGSGIEQLREGLQKLLGSARQIRVNVIEVPNADADAALMAE
YIGQQLERRVSFRRVVRQALQRAERAEVKGIKIQVSGRLNGAEIARTEWVREGRVPLHTL
RADIDYAYRTALTTYGILGIKVWIFKGEVIPGQEAAIVAPPSQPRRKSRRQQFDDRSQDG
Download sequence
Identical sequences L8AHT6 P73314
1148.sll1804 gi|16329935|ref|NP_440663.1| WP_010871973.1.11876 WP_010871973.1.1889 WP_010871973.1.18904 WP_010871973.1.33690 WP_010871973.1.35395 WP_010871973.1.47586 WP_010871973.1.99424 gi|383324847|ref|YP_005385700.1| gi|16329935|ref|NP_440663.1| gi|383321678|ref|YP_005382531.1| gi|383490731|ref|YP_005408407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]