SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329960|ref|NP_440688.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329960|ref|NP_440688.1|
Domain Number 1 Region: 681-852
Classification Level Classification E-value
Superfamily GAF domain-like 4.58e-45
Family GAF domain 0.00064
Further Details:      
 
Domain Number 2 Region: 1203-1368
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-42
Family Histidine kinase 0.00065
Further Details:      
 
Domain Number 3 Region: 543-669
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.03e-23
Family Flavin-binding PAS domain 0.071
Further Details:      
 
Domain Number 4 Region: 856-997
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.4e-21
Family Heme-binding PAS domain 0.06
Further Details:      
 
Domain Number 5 Region: 1133-1213
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000942
Family Homodimeric domain of signal transducing histidine kinase 0.0019
Further Details:      
 
Domain Number 6 Region: 442-544
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000489
Family Heme-binding PAS domain 0.035
Further Details:      
 
Domain Number 7 Region: 999-1124
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000174
Family Heme-binding PAS domain 0.097
Further Details:      
 
Domain Number 8 Region: 109-192
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000206
Family CBS-domain pair 0.012
Further Details:      
 
Domain Number 9 Region: 162-276
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000377
Family CBS-domain pair 0.0095
Further Details:      
 
Weak hits

Sequence:  gi|16329960|ref|NP_440688.1|
Domain Number - Region: 23-145
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00111
Family CBS-domain pair 0.0037
Further Details:      
 
Domain Number - Region: 378-449
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0654
Family Heme-binding PAS domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329960|ref|NP_440688.1|
Sequence length 1371
Comment sensory transduction histidine kinase [Synechocystis sp. PCC 6803]
Sequence
MTFAATPREVTASAIQWACLCLPGELSAAEALNRWHRHGQRSWEPPAEAKAFPPWALVLD
NDGQLLGLLPDWQLAAALWTEHFSPAIALAELCLPCSLRLDLEKLPSLGEVMQIFATWGY
GWDVIPVADRQHQTWGLLSIGNLIRSVNLCQLWQNLPLQVTASPPLCLGTETTLGELVHH
CFERQISSFPVVYSSPLLPAAAPRIPLGNVSLSNYFKGPNYGSLGLDNPIGPDLSPTFPL
CTINQTYCHARELLRRQNDDYVIITNISGAFVGWVGPQQWLATVQPDVLLEALQREVEMP
RIVQHLEARIVWQQQQQQRNQHLIQKLLSRNPNLIYLYDLVKNEIVYLNIPGSLLEGGSG
GAPIPNPMVETDPRQDLLLPPRYFGLEELAALQAHEKKEFNFEFTDGGQSVHYFVVEISA
FEIDGSGQTSKILCLAQDVSHGKRAEAALHTKEQQLQTLVNTIADGIVILDNHDKVIYAN
PMACQMFGLSKEEFLQSQLGLSNRGQTEIGINVSPEEEGIGEIKAVPIHWQGEDCRLVTV
RDVTDRQRVLKKLRDSEQIHRSLLEALPNLVWRLSSAGDVWECNQRTLAYFGRRGRKILG
NTWQQFIEPGERENVQRQWRQGIAAQEFFQLECRLWRSDGQYRWHLLQVLPLEDRFGSIN
GWLASSTDIDDLKEAEKALRNQAQQEKLLSSISQRIRESLKLETILRTTVTEVRRTIHAD
RVLIHHIQEDGLGTTIAESVVNGQPSVMQMDLSPESFPPECYQRYLNGYIYASRDQLPDC
AINCAVQCFTVAESQSRIVAPIVFDHSLWGLLIVHQCSSSRTWQTAEIQLMQSLGNQLAI
AIQQSLLYERLQEELSERQRAEQKLLEVNQLQKGIFDVANYMIISTDRRGIISTFNRTAE
EILGYTAAELIGQQTPLIFHDQEEMASEAVQLSQQLQQTIRPNSIDMFAIPAIQWGVYER
EWTYITKTGDRLPVYVSITALRDDQGKVDGLVGVITDLRRQKQIERERQNLDFVVKNSTE
LIVITDLEQKVTFLNQAGQSLIGLENPETAQTTYLSEHISPEYLNFWQMEIIPQVFRSGA
WEGEFSLQHYQTAVEIPVTASVFLLQGVNGQHPANLVAIVHDITHIKNAEKRILAALEAE
KELGELRSRFISTTSHEFRTPLAIISSSTGILKKYWPKLDGQRRGQHLERIEESVHHMVE
LLDDVLTINRAETKYLPFEPQPLDLVSFCRGITDELQSSTEYHGLLFSYDGLGPGEIVAF
DPKLLRQILTNLLGNAIKYSPSGQPVEFHLQRRGDVGIFSVQDHGIGIGPEDIPNLFDSF
YRGTNVGSIPGTGLGLPIVKKCAELHGGMITVTSQLGQGSRFEVELPLWYS
Download sequence
Identical sequences L8AHW1 P73337 Q79BN1
gi|383324872|ref|YP_005385725.1| gi|383321703|ref|YP_005382556.1| gi|16329960|ref|NP_440688.1| WP_010871998.1.11876 WP_010871998.1.1889 WP_010871998.1.18904 WP_010871998.1.33690 WP_010871998.1.35395 WP_010871998.1.47586 WP_010871998.1.99424 1148.sll1124 gi|383490756|ref|YP_005408432.1| gi|16329960|ref|NP_440688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]