SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329986|ref|NP_440714.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329986|ref|NP_440714.1|
Domain Number 1 Region: 456-629
Classification Level Classification E-value
Superfamily GAF domain-like 2.62e-53
Family GAF domain 0.00035
Further Details:      
 
Domain Number 2 Region: 188-311
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.93e-26
Family Heme-binding PAS domain 0.0095
Further Details:      
 
Domain Number 3 Region: 330-448
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.012
Further Details:      
 
Domain Number 4 Region: 715-834
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000000196
Family Histidine kinase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329986|ref|NP_440714.1|
Sequence length 844
Comment ethylene response sensor protein [Synechocystis sp. PCC 6803]
Sequence
MAITAFTLGDFFQANSYIPHGHCYLWQTPLVWLHVSADFFTAIAYYSIPLTLLYFLRKRQ
DIPFPNIIFLFSTFILCCGTSHFFDIITLWYPIYWISGTVKASMAIVSIITVFELIQIVP
NALNLKSPTELATLNLALNQEIKERQTAEIALQELNNNLEKRVEDRTTQLAKINQQLEQE
IEDKTRAKEDLEKNKDQLAQLAAIVESSQDAIISKTLDGNITSWNESAERLFGYTAEEMI
GSHITKLIPEELILEEDLIAECIRQGQRINTYETQRQRKDGTKIDVALTISPIRDEHKNV
VGASKIVRDITARLDVENALRESQYFIEKLANYSPQILYILDPIAWKNIYVNYQSFEILG
YTPEEFKNGGTELLLNIVHPDDIPTLYENKNFWQKSQEGQVLTTEYRMRHKNGSWRWLRS
REVVFARDDYGQVTKVLGTAQDISDSKEQEQRLYEQGRRESLLREITQRIRQSLDLPTIF
NTVVQEIRQFLEADRVVIFQFSPDSDFSVGNIVAESVLAPFKPIINSAIEETCFSNNYAQ
RYQQGRIQVIEDIHQSHLRQCHIDFLARLQVRANLVLPLINDAILWGLLCIHQCDSSRVW
EQTEIDLLKQITNQFEIAIQQATLYEQAQQELASKNQLFVQLTNELEQKKVLLKEIHHRV
KNNLQIMSSLLYLQFSKASPAIQQLSEEYQNRIQSMALIHEQLYRSEDLANIDFSQYLKN
LTHNICQSYGCNTDSIKIKLLVEQVKVPLEQSIPLGLIIQELVSNALKHAFPTTEGEISI
KFTSMNSHYSLQVWDNGVGISRDIDLENTDSLGMQLIYSLTEQLQGELHYEYVGGAQFGL
EFSL
Download sequence
Identical sequences L8AGK5 P73363
gi|383490782|ref|YP_005408458.1| NYSGRC-FDAO-BAA17394 gi|383321729|ref|YP_005382582.1| 1148.slr1212 gi|16329986|ref|NP_440714.1| WP_010872024.1.11876 WP_010872024.1.1889 WP_010872024.1.18904 WP_010872024.1.33690 WP_010872024.1.35395 WP_010872024.1.47586 WP_010872024.1.99424 gi|383324898|ref|YP_005385751.1| gi|16329986|ref|NP_440714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]