SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330010|ref|NP_440738.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330010|ref|NP_440738.1|
Domain Number 1 Region: 7-228
Classification Level Classification E-value
Superfamily Ribosomal protein L1 7.98e-81
Family Ribosomal protein L1 0.000000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330010|ref|NP_440738.1|
Sequence length 238
Comment 50S ribosomal protein L1 [Synechocystis sp. PCC 6803]
Sequence
MTKKLSKRMQAAIAKVDDSKLYSPLEAMELLKETATAKFDETAEAHIRLGIDPKYSDQQI
RTTVSLPKGTGQTVRVAVLARGEKVKEATDAGADIAGSEELIEEIQKGMMDFDVLIATPD
MMPKIARLGKQLGPRGLMPSPKGGTVTADLAAAVNEFKAGKLEFRADRTGIVHVMFGKAS
FSADDLLANLKALQETIDRNRPSGAKGRFWRTVFVSSSMGPSIPVDINALRDLKFEDN
Download sequence
Identical sequences L8AIA5 P36236
gi|383324922|ref|YP_005385775.1| 1148.sll1744 gi|383321753|ref|YP_005382606.1| gi|383490806|ref|YP_005408482.1| gi|16330010|ref|NP_440738.1| WP_010872048.1.11876 WP_010872048.1.1889 WP_010872048.1.18904 WP_010872048.1.33690 WP_010872048.1.35395 WP_010872048.1.47586 WP_010872048.1.99424 gi|16330010|ref|NP_440738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]