SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330012|ref|NP_440740.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330012|ref|NP_440740.1|
Domain Number 1 Region: 21-143
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.44e-32
Family N-utilization substance G protein NusG, N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 133-204
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.32e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330012|ref|NP_440740.1|
Sequence length 205
Comment transcription antitermination protein NusG [Synechocystis sp. PCC 6803]
Sequence
MSFTDDQSPVAEQNKKTPSEGHWFAVQVASGCEKRVKLNLEQRIHTLDVADRILQVEIPK
TPIVKIRKDGARVQGEEKIFPGYVLIRMIMDDDAWQVVKNTPHVINFVGSEQKRHYGRGR
GHVLPMPLSHGEVERIFRHVDEQEPVVKIDMEIGDHIMVLSGPFKDFEGDVIEVSPERSK
LKALLSIFGRETPVELEFTQVEKQN
Download sequence
Identical sequences L8AEK4 P36265
gi|383324924|ref|YP_005385777.1| gi|16330012|ref|NP_440740.1| gi|383490808|ref|YP_005408484.1| gi|383321755|ref|YP_005382608.1| gi|16330012|ref|NP_440740.1| 1148.sll1742 WP_010872050.1.11876 WP_010872050.1.1889 WP_010872050.1.18904 WP_010872050.1.33690 WP_010872050.1.35395 WP_010872050.1.47586 WP_010872050.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]