SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330018|ref|NP_440746.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330018|ref|NP_440746.1|
Domain Number 1 Region: 65-213
Classification Level Classification E-value
Superfamily FtsH protease domain-like 3.79e-22
Family FtsH protease domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330018|ref|NP_440746.1|
Sequence length 231
Comment hypothetical protein sll1738 [Synechocystis sp. PCC 6803]
Sequence
MSDSRLNLVAIAIFLMMMSALVGPIVHLSPAIPAAATLGILGIITADQISWQGKGTDFFV
GLFQTKAEKERILCHEAGHFLVAHCLQIPITNYSLSPWEVLRQGAGGMAGIQFDTTNLEN
QCRDWHLRPQALERWATVWMAGIAAEKIIYGESQGGNGDRQQLRQAFRRAGLPEIKLQQK
ESWAFLQAKNLLEQHRQAHGQLQQALAQRRSVEECRHLLAQHLGEPAVGSN
Download sequence
Identical sequences L8AGN6 P73386
gi|383490814|ref|YP_005408490.1| gi|383321761|ref|YP_005382614.1| gi|383324930|ref|YP_005385783.1| gi|16330018|ref|NP_440746.1| gi|16330018|ref|NP_440746.1| WP_010872056.1.11876 WP_010872056.1.1889 WP_010872056.1.18904 WP_010872056.1.33690 WP_010872056.1.35395 WP_010872056.1.47586 WP_010872056.1.99424 1148.sll1738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]