SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330069|ref|NP_440797.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330069|ref|NP_440797.1|
Domain Number 1 Region: 170-439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.05e-70
Family Extended AAA-ATPase domain 0.0000000607
Further Details:      
 
Domain Number 2 Region: 426-620
Classification Level Classification E-value
Superfamily FtsH protease domain-like 3.4e-69
Family FtsH protease domain-like 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330069|ref|NP_440797.1|
Sequence length 628
Comment cell division protein FtsH [Synechocystis sp. PCC 6803]
Sequence
MAIKPQPQWQRRLASVLLWGSTIYLLVNLLAPALFRSQPPQVPYSLFIDQVEGDKVASVY
VGQNEIRYQLKPEAEDEGKEKAAEGQILRTTPIFDLELPKRLEAKGIEFAAAPPAKNSWF
GTLLSWVIPPLIFVGIWSFFLNRNNNGAPGGALAFTKSKAKVYVEGDSTKVTFDDVAGVE
EAKTELSEVVDFLKFPQRYTALGAKIPKGVLLVGPPGTGKTLLAKAAAGEAGVPFFIISG
SEFVELFVGAGAARVRDLFEQAKKQAPCIVFIDELDAIGKSRASGAFMGGNDEREQTLNQ
LLTEMDGFSAAGATVIVLAATNRPETLDPALLRPGRFDRQVLVDRPDLAGRLKILEIYAK
KIKLDKEVELKNIATRTPGFAGADLANLVNEAALLAARNKQDSVTEADFREAIERVVAGL
EKKSRVLSDKEKKIVAYHEVGHALVGAVMPGGGQVAKISIVPRGMAALGYTLQMPTEDRF
LLNESELRDQIATLLGGRAAEEIVFDSITTGAANDLQRATDLAEQMVTTYGMSKVLGPLA
YDKGQQNNFLGQGMGNPRRMVSDDTAKEIDLEVKEIVEQGHNQALAILEHNRDLLEAIAE
KILEKEVIEGEELHHLLGQVQAPGTLVV
Download sequence
Identical sequences L8AI69 P73437
gi|383321812|ref|YP_005382665.1| gi|16330069|ref|NP_440797.1| gi|383490865|ref|YP_005408541.1| 1148.sll1463 WP_010872107.1.11876 WP_010872107.1.1889 WP_010872107.1.18904 WP_010872107.1.33690 WP_010872107.1.35395 WP_010872107.1.47586 WP_010872107.1.99424 gi|383324981|ref|YP_005385834.1| gi|16330069|ref|NP_440797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]