SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330095|ref|NP_440823.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330095|ref|NP_440823.1|
Domain Number 1 Region: 87-160
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.0000000000569
Family MTH1895 0.012
Further Details:      
 
Domain Number 2 Region: 8-76
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.00000000135
Family MTH1895 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330095|ref|NP_440823.1|
Sequence length 317
Comment hypothetical protein slr1220 [Synechocystis sp. PCC 6803]
Sequence
MTIDNIRLRNEFINTEVITRSSGKKLGVVKEVLVDVDQREIVALGLRDNFLSLTGMPQYL
YLNSIVQTGDVVLVENDDVFELVEVDLYSPLVNSEVVTETGEPLGRVRDFQFDLATGKVS
SIIIASLGLPQIPDQLISTYELSIDEVVSSGPNRLIVFEGAEERLNQLSVGLLERLGIGR
PSWERMEEDLYYPPTTRPENQLGSGIPVRPPVQVRQPEPVLEERWNEDDWQDTRPAPPPR
REVAPLRYPEPEYEDDYEVDNWGEASSRSSAPEPDYDYEDGVAGDVWDDDEAPAPYSPPR
VNIPETRREKMPEYYEE
Download sequence
Identical sequences L8AIH4 P73463
gi|383325007|ref|YP_005385860.1| gi|383321838|ref|YP_005382691.1| WP_010872133.1.11876 WP_010872133.1.1889 WP_010872133.1.18904 WP_010872133.1.33690 WP_010872133.1.35395 WP_010872133.1.47586 WP_010872133.1.99424 gi|383490891|ref|YP_005408567.1| 1148.slr1220 gi|16330095|ref|NP_440823.1| gi|16330095|ref|NP_440823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]