SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330113|ref|NP_440841.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330113|ref|NP_440841.1|
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily HIT-like 4.33e-39
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330113|ref|NP_440841.1|
Sequence length 114
Comment protein kinase C inhibitor [Synechocystis sp. PCC 6803]
Sequence
MAEDTIFSKIIRREIPAAIVYEDDLCLAFKDVNPQAPVHVLLIPKKPLPQLSAATPEDHA
LLGHLLLKAKEVAADLGIGDQFRLVINNGAEVGQTVFHLHLHILGGRPFSWPPG
Download sequence
Identical sequences L8AIB8 P73481
gi|16330113|ref|NP_440841.1| WP_010872151.1.11876 WP_010872151.1.1889 WP_010872151.1.18904 WP_010872151.1.33690 WP_010872151.1.35395 WP_010872151.1.47586 WP_010872151.1.99424 gi|16330113|ref|NP_440841.1| gi|383325025|ref|YP_005385878.1| gi|383490909|ref|YP_005408585.1| 1148.slr1234 gi|383321856|ref|YP_005382709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]