SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330125|ref|NP_440853.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330125|ref|NP_440853.1|
Domain Number 1 Region: 131-318
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.52e-51
Family ATP-binding domain of peptide synthetases 0.0000267
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.16e-36
Family Prokaryotic glutathione synthetase, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330125|ref|NP_440853.1|
Sequence length 320
Comment glutathione synthetase [Synechocystis sp. PCC 6803]
Sequence
MKLAFIIDPLEKLDPGHDSTVAIMEAAQKLGHEVFVTSVGDLAVINGQAWAKLAAVRLQP
VILVDGHWQVSQPWSELSKSQWMALTECQAVFMRKDPPVTVQYLYATFILELLAPTKTMV
INSPQGLREANEKMYTLQFAAVMPPTVVSLDKGLIRQFLEEHGAAVLKPLGGKAGEGILF
LDPGDRNFNSLVEISTQHGKEPVMVQRFLPEAKEGDKRIILLDGDPIGAVNRIPSGAEFR
GNMAVGGQVAPTTITSREIEICALLKPKLQADGLYFVGIDVIGGYLTEVNVTSPTGIREI
DRLEGVRLGEKVICWLEKQF
Download sequence
Identical sequences L8AGY2 P73493
gi|383325037|ref|YP_005385890.1| gi|383490921|ref|YP_005408597.1| gi|16330125|ref|NP_440853.1| 1148.slr1238 gi|383321868|ref|YP_005382721.1| WP_010872163.1.11876 WP_010872163.1.1889 WP_010872163.1.18904 WP_010872163.1.33690 WP_010872163.1.35395 WP_010872163.1.47586 WP_010872163.1.99424 gi|16330125|ref|NP_440853.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]