SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330194|ref|NP_440922.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330194|ref|NP_440922.1|
Domain Number 1 Region: 27-257
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.1e-36
Family Alanine racemase-like, N-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 223-376
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 4.6e-30
Family Eukaryotic ODC-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330194|ref|NP_440922.1|
Sequence length 387
Comment carboxynorspermidine decarboxylase [Synechocystis sp. PCC 6803]
Sequence
MSSFAVNILENPRLSSLPSPCFVLEEELLQQNLAIFERLQQSAPIEVMLALKGFALFPCF
PWLRSGLAGASASSLWEARLAAEEFGKEVHVYAPTYRPDDLPAIIPLASHITFNSLGQWH
RYRESLKNTAVKAGLRINPEYSPVQTDLYNPCVSGSRLGVQAAMLAGNLPSGITGFLSHN
LCESDHLALEKTLGQIEKLFGEYLPQIEWLNLGGGHLMTSQGYDMDYAIAVIGEFHQRHP
HLRLIMEPGSAIAWQTGFLLSTVEDLIETPEFTHAMLDVSFTAHMPDCLEMPYRPEVRGA
RVPQTGDTVYRLGGSSCLAGDFLGDYAFDQPLQVGDRLIFEDMMHYTMVKTTTFNGVHHP
AIGCLRRSGEFELWRTFGYEDYRNRLG
Download sequence
Identical sequences P73562
gi|383321937|ref|YP_005382790.1| 1148.sll0873 gi|16330194|ref|NP_440922.1| gi|383325106|ref|YP_005385959.1| gi|16330194|ref|NP_440922.1| WP_010872232.1.11876 WP_010872232.1.1889 WP_010872232.1.18904 WP_010872232.1.33690 WP_010872232.1.35395 WP_010872232.1.47586 WP_010872232.1.99424 gi|383490990|ref|YP_005408666.1| NYSGRC-FDAO-BAA17602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]