SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330219|ref|NP_440947.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330219|ref|NP_440947.1|
Domain Number 1 Region: 45-213,274-293
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 6.8e-89
Family Cytochrome f, large domain 0.0000000934
Further Details:      
 
Domain Number 2 Region: 290-328
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00000000000000824
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00094
Further Details:      
 
Domain Number 3 Region: 214-274
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000848
Family Cytochrome f, small domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330219|ref|NP_440947.1|
Sequence length 328
Comment apocytochrome f [Synechocystis sp. PCC 6803]
Sequence
MRNPDTLGLWTKTMVALRRFTVLAIATVSVFLITDLGLPQAASAYPFWAQETAPLTPREA
TGRIVCANCHLAQKAAEVEIPQAVLPDTVFEAVVKIPYDLDSQQVLGDGSKGGLNVGAVL
MLPEGFKIAPPDRLSEGLKEKVGGTYFQPYREDMENVVIVGPLPGEQYQEIVFPVLSPDP
AKDKSINYGKFAVHLGANRGRGQIYPTGLLSNNNAFKAPNAGTISEVNALEAGGYQLILT
TADGTETVDIPAGPELIVSAGQTVEAGEFLTNNPNVGGFGQKDTEVVLQNPTRIKFLVLF
LAGIMLSQILLVLKKKQIEKVQAAELNF
Download sequence
Identical sequences P26287
gi|383325131|ref|YP_005385984.1| WP_010872257.1.11876 WP_010872257.1.1889 WP_010872257.1.18904 WP_010872257.1.33690 WP_010872257.1.35395 WP_010872257.1.47586 WP_010872257.1.99424 gi|16330219|ref|NP_440947.1| 1148.sll1317 gi|16330219|ref|NP_440947.1| gi|383321962|ref|YP_005382815.1| gi|383491015|ref|YP_005408691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]