SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330244|ref|NP_440972.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330244|ref|NP_440972.1|
Domain Number 1 Region: 142-481,510-585
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.42e-133
Family Amylase, catalytic domain 0.00000026
Further Details:      
 
Domain Number 2 Region: 20-152
Classification Level Classification E-value
Superfamily E set domains 6.3e-30
Family E-set domains of sugar-utilizing enzymes 0.0059
Further Details:      
 
Domain Number 3 Region: 599-707
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.94e-24
Family alpha-Amylases, C-terminal beta-sheet domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330244|ref|NP_440972.1|
Sequence length 707
Comment glycogen operon protein GlgX [Synechocystis sp. PCC 6803]
Sequence
MERIDIHPTHTANGYKLRCGQPFPFGATIVPGGVNFSIYSSHSTACTLVLFEKRAPQPFV
EIPFPESFRIGNVYCMVVFDLDFENLEYGYRMEGPNNFQQGHWFDPSKVLLDPYAKVVSG
RDVWGTQPNWDDIYQHRGRLSFDDFDWENDSPLDVPLEDMVIYEMHVRGFTKDPSSGVKE
NHRGTFAGILSKIPYLQELGVNTIELMPIFEFDEFEHSRYHPETGEFLVNYWGYSTVNFF
APKAGYAATGKFGMQIDELKNLVKELHKVGISVILDVVFNHTAEGNERGPTISFRGLDNK
TYYMLTPEGYYFNFSGTGNTLNCNNPIVRGMVLDCLRYWTAEFHIDGFRFDLASILGRDP
WGYPLANPPLLETLAFDPILARSKLIAEAWDAGGLYQVGSFPSYGRWAEWNGKYRDTVRK
FIKGDAGVIGEMAQRLQGSPDLYQGAGRPPSTSINFVTAHDGFTLADLVAYNGKHNYANG
ENGNDGANDNYSWNCGVEGPTDNPDILRLRARQMRNAIAILLVSQGVPMLLMGDEMGKTQ
DGNNNTYCHDSPFNWLNWHLLEQNQAWFRFVKHCIAFRLAHPVLRNSEHFQNCDYLGVGF
PDISWHGVKPWHADWSADSRVLAFMLCGRHAKGGRVKDNQIYVAMNMHYESLWFELPAPP
VGTTWHVFANTGAQPPEDIHPPGQEPPLSSQSSLLIGDRSVVILLAK
Download sequence
Identical sequences L8AIY8 P73608
gi|16330244|ref|NP_440972.1| 1148.slr1857 WP_010872282.1.11876 WP_010872282.1.1889 WP_010872282.1.18904 WP_010872282.1.33690 WP_010872282.1.35395 WP_010872282.1.47586 WP_010872282.1.99424 gi|383325156|ref|YP_005386009.1| gi|383491040|ref|YP_005408716.1| NYSGRC-FDAO-BAA17652 gi|16330244|ref|NP_440972.1| gi|383321987|ref|YP_005382840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]