SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330253|ref|NP_440981.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330253|ref|NP_440981.1|
Domain Number 1 Region: 82-199
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000608
Family Sensory domain of two-component sensor kinase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330253|ref|NP_440981.1|
Sequence length 333
Comment hypothetical protein slr1866 [Synechocystis sp. PCC 6803]
Sequence
MQSWRHRFLSYVLLACLSCTSFTAFIIYVNLRQAVIQPTFEFLTEMTEVKIEQSNHWFSQ
LKTDFKADLTDTQVKKNASILLTQRLNTNPEYQQAYHYLHKHFNQKYQQRLATSLITNSG
MVIFSTDPNQEGQYRPLQNTTTYFKLENINNFTPNFYQSATNQLPMITLATPLFDQSEKR
IGVLTIDLNLSDLDQWIRQPVAQEENTEQLMGEVESYLVGGLSLTTNTFVSQNIHRGENK
INTTEDVISIPTLKSNGINRALEMESGQGMYLNYEQIPVLGVYRWLPAYRFALLVEVRQA
KVFSFARFRAGQLFVGGLVFTLAASFGLLLIKI
Download sequence
Identical sequences L8AIJ5 P73616
gi|383325163|ref|YP_005386016.1| gi|383321994|ref|YP_005382847.1| 1148.slr1866 gi|16330253|ref|NP_440981.1| WP_010872291.1.11876 WP_010872291.1.1889 WP_010872291.1.18904 WP_010872291.1.33690 WP_010872291.1.35395 WP_010872291.1.47586 WP_010872291.1.99424 gi|383491047|ref|YP_005408723.1| gi|16330253|ref|NP_440981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]