SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330262|ref|NP_440990.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330262|ref|NP_440990.1|
Domain Number 1 Region: 303-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.28e-43
Family ABC transporter ATPase domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 54-290
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 6.67e-22
Family DNA repair protein MutS, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 747-822
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000445
Family Smr domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330262|ref|NP_440990.1|
Sequence length 822
Comment recombination and DNA strand exchange inhibitor protein [Synechocystis sp. PCC 6803]
Sequence
MSDSTNLTIAEETLALLEWPRLCQHLSTFTQTPLGAIAARYLLPPSQWEESRELLAQTQA
VESIENSPESNWHFKGIADITEPLARVERGGLVTGLELLAIAGTLAGVRRLRRVIEERDD
LEILQTLVAEVRTLPELEQAIHHCLGEDGKVAERASPKLGEIRQKLKAVREQIQQKLQKI
IQRQSNALQEAVITQRGDRFVLPIKAGYKEQMPGIVHDSSASGNTLYVEPQAIVELGNKL
RQARRQEQTEEERILRQLSDQVLEVLLDLEHLLAIATRLDLATARVRYSFWLGAHPPQWL
TPGDEKPITLRQLRHPLLHWQAEKEGGPAVVPITLTIDSQIRVIAITGPNTGGKTVTLKT
LGLVALMAKVGLYIPAKETVEMPWFAQILADIGDEQSLQQNLSTFSGHICRIIRILQALP
SGVQDVLDPEIDSPNHPIFPSLVLLDEVGAGTDPTEGSALAIALLRHLADQPCLTVATTH
YGELKALKYQDARFENASVEFDDQSLSPTYRLLWGIPGRSNALAIAQRLGLPLAIVEQAK
DKLGGFSEDINQVIAGLESQRREQEQKAANAQKLLQETEIFYQQVSQKAASLQARERELK
SYQDQEVQQAIAAAKEEIAKVIRQLQRGKPSAQKAQQATEILGQIQAEQKAKVAPKPIGY
QPTVGERIRIPSFGQTAEVTQVNATAQTVNVTLGLMKMTVPMADIESLNGKKVEPPPKSE
PVPKKVKAEPPATEAKSPPVLVRTEKNTLDCRGDRLERAESRLEKALNQALDAGVLWIIH
GKGTGKLRQGVQEYLSHHPLVKSYALAPQNDGGAGVTIAYLR
Download sequence
Identical sequences L8AIT3 P73625
gi|383322003|ref|YP_005382856.1| gi|16330262|ref|NP_440990.1| WP_010872300.1.11876 WP_010872300.1.1889 WP_010872300.1.18904 WP_010872300.1.33690 WP_010872300.1.35395 WP_010872300.1.47586 WP_010872300.1.99424 gi|383491056|ref|YP_005408732.1| SgR51 gi|16330262|ref|NP_440990.1| gi|383325172|ref|YP_005386025.1| 1148.sll1772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]