SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330263|ref|NP_440991.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330263|ref|NP_440991.1|
Domain Number 1 Region: 12-247
Classification Level Classification E-value
Superfamily PP2C-like 4.19e-60
Family PP2C-like 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330263|ref|NP_440991.1|
Sequence length 254
Comment hypothetical protein sll1771 [Synechocystis sp. PCC 6803]
Sequence
MTEVNLSVVSCSSTGKTDPGLVRQYNQDSFYLDPEGRFYIVADGMGGHAGGEEASRIAVE
RVRDYLDTYWQSEITSEQLLRDALMDANEGILEDQKINLERRDMGTTAVLIAFREDGAWR
AHVGDSRLYRLRNQQLERVTEDHTWVARALKMGDIDPAQAKVHPWRHVLFQCLGRQDLNF
IEVEALDAQPGDTFMMCSDGLTEEVPDNLIEKILTGQGNCDDQAVQLIEEAKNAGGSDNI
TIVLVDFSEDNQDS
Download sequence
Identical sequences L8AFE6 P73626
WP_010872301.1.11876 WP_010872301.1.1889 WP_010872301.1.18904 WP_010872301.1.33690 WP_010872301.1.35395 WP_010872301.1.47586 WP_010872301.1.99424 gi|16330263|ref|NP_440991.1| gi|383322004|ref|YP_005382857.1| gi|16330263|ref|NP_440991.1| gi|383325173|ref|YP_005386026.1| gi|383491057|ref|YP_005408733.1| 1148.sll1771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]