SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330269|ref|NP_440997.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330269|ref|NP_440997.1|
Domain Number 1 Region: 127-345
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.41e-55
Family ATP-binding domain of peptide synthetases 0.00013
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.55e-33
Family D-Alanine ligase N-terminal domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330269|ref|NP_440997.1|
Sequence length 354
Comment D-alanyl-alanine synthetase A [Synechocystis sp. PCC 6803]
Sequence
MRVGLLFGGCSGEHEVSIKSAQAIAKALASDDNQTKYQVSPFYIQKNGVWLGPDVSQQVL
DQGVPWGDQPVTAGQRWQFPPEAARMEVWFPILHGPNGEDGTVQGLFSLMQVPYVGSGVL
GSCVGMDKLAMKMVFERAGLPQVNYMGVERGEIWSNPCVFPALCEKIEAQVGYPCFVKPA
NLGSSVGIAKVRNRSELEAALDNAASYDRRIIVEAGLTDIREVECAVLGNENPQASVVGE
ITYDSDFYDYETKYTDGRSQMHIPANLPKAVVNQIQTMAIQAFKAVDAAGLGRLDFFYQP
TTGQIVINEINTLPGFTAFSMYPELWRASGVEFPSLVDRLLQLALDYHGRPGHQ
Download sequence
Identical sequences L8AJ54 P73632
gi|16330269|ref|NP_440997.1| NYSGRC-FDAO-BAA17677 1148.slr1874 gi|16330269|ref|NP_440997.1| gi|383322010|ref|YP_005382863.1| gi|383491063|ref|YP_005408739.1| WP_010872307.1.11876 WP_010872307.1.1889 WP_010872307.1.18904 WP_010872307.1.33690 WP_010872307.1.35395 WP_010872307.1.47586 WP_010872307.1.99424 gi|383325179|ref|YP_005386032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]