SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330276|ref|NP_441004.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330276|ref|NP_441004.1|
Domain Number 1 Region: 26-356
Classification Level Classification E-value
Superfamily Radical SAM enzymes 3.01e-29
Family MoCo biosynthesis proteins 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330276|ref|NP_441004.1|
Sequence length 398
Comment arylsulfatase [Synechocystis sp. PCC 6803]
Sequence
MQALVNQTQPINESIRDVDITNFGPTNLIIIQPTSYCNLDCDYCYLPDRHLKNHLPLDLL
EPIMQAIFASPFTTSNFSLCWHAGEPLAAGLEFYRQAFAKIETYGEKYNHRQLWFDHSFQ
SNGILINQAWCDLFKQYPVHVGISLDGPAFLHDKHRKTRTGRGSHAATMRGIEWLQKNDI
CHSVIAVLTEESLDYPDEIFHFFRDHNLLDVGFNMEETEGINTESSLNKQGTLQKYRQFL
ERFWQLTSTSEPEFRVREFECLCNLIYTEDRLDHTDMNRPFAIVSIDHQGNFSTFDPELL
AIKTPQYGDFIFGNVLTDSFASICQTEKFQRIYHDMTQGVEKCRQTCDYFGLCGGGAGSN
KFWENGSFNSTETLACRFRIQQVAEVVIGALEESLGLA
Download sequence
Identical sequences L8AFI2 P73639
WP_010872314.1.11876 WP_010872314.1.1889 WP_010872314.1.18904 WP_010872314.1.33690 WP_010872314.1.35395 WP_010872314.1.47586 WP_010872314.1.99424 gi|383322017|ref|YP_005382870.1| gi|383491070|ref|YP_005408746.1| gi|16330276|ref|NP_441004.1| gi|383325186|ref|YP_005386039.1| 1148.sll1766 gi|16330276|ref|NP_441004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]