SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330299|ref|NP_441027.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330299|ref|NP_441027.1|
Domain Number 1 Region: 375-696
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 1.64e-95
Family Phosphotransacetylase 0.000000235
Further Details:      
 
Domain Number 2 Region: 1-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.12e-26
Family Nitrogenase iron protein-like 0.027
Further Details:      
 
Domain Number 3 Region: 212-332
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 6.28e-21
Family DRTGG domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330299|ref|NP_441027.1|
Sequence length 697
Comment phosphate acetyltransferase [Synechocystis sp. PCC 6803]
Sequence
MTSSLYLSTTEARSGKSLVVLGILDLILKKTTRIAYFRPIIQDPVNGKHDNNIILVLENF
RLQQTYTDSFGLYFHEAVSLASDGAIDQVLDRILAKYRHLADQVDFILCEGSDYLGEESA
FEFDLNTTIAKMLNCPILLLGNAMGNTIADSLQPIDMALNSYDQESCQVVGVIINRVQPE
LATEIQAQLEQRYGDRPMVLGTIPQDIMLKSLRLREIVSGLNAQVLSGADLLDNLVYHHL
VVAMHIAHALHWLHEKNTLIITPGDRGDIILGVMQAHRSLNYPSIAGILLTADYHPEPAI
MKLIEGLPDAPPLLLTSTHTHETSARLETLHPALSPTDNYKIRHSIALFQQQIDGEKLLN
YLKTIRSKGITPKLFLYNLVQAATAAQRHIVLPEGEEIRILKAAASLINHGIVRLTLLGN
IEAIEQTVKINHIDLDLSKVRLINPKTSPDRERYAETYYQLRKHKGVTLAMARDILTDIS
YFGTMMVHLGEADGMVSGSVNTTQHTVRPALQIIKTQPGFSLVSSVFFMCLEDRVLVYGD
CAVNPDPNAEQLAEIALTSAATAKNFGIEPRVALLSYSSGSSGQGADVEKVRQATAIAKE
REPDLALEGPIQYDAAVDSTVAAQKMPGSAVAGKATVFIFPDLNTGNNTYKAVQRETKAI
AIGPILQGLNKPVNDLSRGCLVEDIINTVVITALQVK
Download sequence
Identical sequences L8AJ80 P73662
gi|383325209|ref|YP_005386062.1| gi|16330299|ref|NP_441027.1| gi|383491093|ref|YP_005408769.1| WP_010872337.1.11876 WP_010872337.1.1889 WP_010872337.1.18904 WP_010872337.1.33690 WP_010872337.1.35395 WP_010872337.1.47586 WP_010872337.1.99424 gi|383322040|ref|YP_005382893.1| 1148.slr2132 gi|16330299|ref|NP_441027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]