SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330336|ref|NP_441064.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16330336|ref|NP_441064.1|
Domain Number - Region: 21-119
Classification Level Classification E-value
Superfamily ARM repeat 0.0345
Family MIF4G domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330336|ref|NP_441064.1|
Sequence length 158
Comment hypothetical protein slr1812 [Synechocystis sp. PCC 6803]
Sequence
MVAELRKTNQNLYETDYNLWVLETVVKLKNKDLDNLDWENLIEEVEDLSRRDKKKLKSLL
RLLFEHLLKLSYWKSEEQNNRNHWEAEIINFRQLIEDELADSPSLKVYLQEIWQECYQYG
RKIAAKRSQLPLSTFPEEPIATLEQILNEDWLPYAIAR
Download sequence
Identical sequences L8AIU3 P73697
gi|383491130|ref|YP_005408806.1| gi|383322077|ref|YP_005382930.1| gi|16330336|ref|NP_441064.1| gi|383325246|ref|YP_005386099.1| gi|16330336|ref|NP_441064.1| 1148.slr1812 WP_010872374.1.11876 WP_010872374.1.1889 WP_010872374.1.18904 WP_010872374.1.33690 WP_010872374.1.35395 WP_010872374.1.47586 WP_010872374.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]