SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330348|ref|NP_441076.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330348|ref|NP_441076.1|
Domain Number 1 Region: 191-325
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.42e-36
Family Pentapeptide repeats 0.00038
Further Details:      
 
Domain Number 2 Region: 14-138
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 8.24e-33
Family Pentapeptide repeats 0.00071
Further Details:      
 
Domain Number 3 Region: 146-211
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.61e-17
Family Pentapeptide repeats 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330348|ref|NP_441076.1|
Sequence length 331
Comment hypothetical protein slr1819 [Synechocystis sp. PCC 6803]
Sequence
MEAKELVQRYRNGETLFTGLKLPGINLEAADLIGIVLNEADLRGANLLFCYLNRANLGQA
NLVAANLSGASLNQADLAGADLRSANFHGAMLQGAILRDSDMTLATLQDTNLIGADLRGA
DLSGATLTGACLRGANMRQEKKGYYTNLQAAILGRADLQGANMKGVDLSRADLSYANLKE
ANLRDVDLRKADLSYANLKGALLTDANLSGAKLNGADLQNANLMRAKISEAEMTAVNCQG
AIMTHVNLNRTNLTGSNLSFTRMNSADLSRANLTKANLQEAELIEAFFARANLTEANFIN
ANLVRADLMSANMVGADFQGATMPDGQVRHH
Download sequence
Identical sequences P73709
gi|16330348|ref|NP_441076.1| gi|383322089|ref|YP_005382942.1| 1148.slr1819 gi|16330348|ref|NP_441076.1| WP_010872386.1.1889 WP_010872386.1.33690 WP_010872386.1.35395 WP_010872386.1.47586 WP_010872386.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]