SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330352|ref|NP_441080.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330352|ref|NP_441080.1|
Domain Number 1 Region: 806-964
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.1e-48
Family GGDEF domain 0.0000298
Further Details:      
 
Domain Number 2 Region: 94-204
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.27e-25
Family Flavin-binding PAS domain 0.071
Further Details:      
 
Domain Number 3 Region: 200-331
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.15e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.081
Further Details:      
 
Domain Number 4 Region: 455-572
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.17e-18
Family Heme-binding PAS domain 0.03
Further Details:      
 
Domain Number 5 Region: 637-796
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-18
Family GAF domain 0.0058
Further Details:      
 
Domain Number 6 Region: 330-456
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000136
Family Heme-binding PAS domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330352|ref|NP_441080.1|
Sequence length 970
Comment hypothetical protein sll1687 [Synechocystis sp. PCC 6803]
Sequence
MRVSDKNSRLHSYQYQLYPLVNGGSQNYMGDEHQDIGKVIAKLETSKEVVANLKLQTFLR
SAFLSEASHINSGEDVGKFLEAILQEGEEMFNYLANHAPVLIWIAGLDKGCFYFNQPWLN
FTGRTLEQEQGNGWAEGVHPDDFDRCWQTYVEAFDARQPFTMEYRLRNRGGEYRWLLDNG
VPRLAPDGEFLGYIGSCIDITERYEARQAIEESEEKYRSLVESINTIIVRWLPTGEITFA
NEYCHNFFGFSKEEMVGKSVFDTIVPRTSSSGQNLEAMVADICRNPENYKYNENENVRKN
GDRVWVAWTNEPIFDSQGNLLEILGSGIDITSRKLAEEQLRQREAELSEAQSLAKLGTWK
FLSGSGEIQWSEEILRMFGLEHPPSYEELTASIHPGDRQRHDEVVQSVLESQNSQDLVYR
FFRQDGSQGWLWAKIEALVNGAGEMIGLHGVAMDVTEQKSVETALQDSESRFRKVFESAV
VGMMFANINGQITEANDCLLKMLGYTRKELEAGLMRWDQITPPEYKSQDLEAIENLRIYG
FTKPWEKEYYHKNGRRVPILMGASPFEGEPDLTICVVVPMEEQKKALYQRDRIEAELEKL
NAKLEQRVLERTQALAESQEQVNRVNEQLAQRLEELKRRNQEMELLSTLNQYLQSCVVVA
DACASLAALAPPLFPNIAGTISIFDSTANYFEQVKTWGNLACSEPLFNGTDCWALRLGQP
HLVGVQQHDLLCSHLNPECLPQESLCIPLIAQGETLGLLNLCSDRAGVISSDQQQLAKAV
AEQVSLAIANIKLRERLENQSIRDPLTGLFNRRYLEQFFLQEIGRAKRYNHSIGVIMGDI
DHFKQFNDQLGHDAGDHVLKTIGRILQSNIRGSDIACRYGGEEMTIVLPQTSLEDTLVKA
ESLRQAIASMEVEYKGKELGTLTVSLGVACYPNHGETMVNIIQAADRALYQAKAAGRNRV
VMADEVFPVN
Download sequence
Identical sequences P73713
1148.sll1687 gi|383325262|ref|YP_005386115.1| gi|16330352|ref|NP_441080.1| gi|16330352|ref|NP_441080.1| gi|383322093|ref|YP_005382946.1| WP_010872390.1.11876 WP_010872390.1.1889 WP_010872390.1.18904 WP_010872390.1.33690 WP_010872390.1.35395 WP_010872390.1.47586 WP_010872390.1.99424 gi|383491146|ref|YP_005408822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]