SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330413|ref|NP_441141.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330413|ref|NP_441141.1|
Domain Number 1 Region: 337-636
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 7.19e-89
Family DNA repair protein MutS, domain III 0.00000146
Further Details:      
 
Domain Number 2 Region: 638-874
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.38e-56
Family ABC transporter ATPase domain-like 0.00000086
Further Details:      
 
Domain Number 3 Region: 173-237,267-349
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 2.49e-41
Family DNA repair protein MutS, domain II 0.00044
Further Details:      
 
Domain Number 4 Region: 54-171
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 9.94e-36
Family DNA repair protein MutS, domain I 0.0000829
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330413|ref|NP_441141.1|
Sequence length 912
Comment DNA mismatch repair protein MutS [Synechocystis sp. PCC 6803]
Sequence
MDCRLKCTNQCTSLMMAFDKSHTIKGCSTEFSLSMTDTPILGTVKEPQRDYRTLDRQKLT
PMFQHYTEVKEQYQGALLLYRVGDFFECFFQDAVIIARELELILTSKEGGKEIGRVAMTG
VPHHALDRYARQLVEKGYAVAICDQVEDAAEAQAEKRMVERQVTKLLTPGTLTDDSMLPA
KRNNFLAAIAMVEDKWGLAHADISTGEFFTCQSSNLDDLAVELLRLQPSEVLIPTSAPDI
RNILRPGEPSEHIPKQLPTSFCYSLRSQAPFSLVEAKQRLLTTFRVKSLEGMGCEGLPLA
IRAAGGLLEYIEDTQKAHVVPIQPLKTYGLTDFLVLDHQTRRNLEINQTVRDGSFHGSLL
WALDRTSTTMGSRALRRWLLQPLLDLKGIQARQDTIQELYHHPALRQDLRQLLRQIYDLE
RLTGRIGANTASARDVYGLASSLVRLTDLAELAQEGHSPYLKALQTVPPELEELGKYVLA
HIVENPPLHIREGNLIRSGVNPTLDEMRQSLEDDNQWLANLEVTEREKTGIANLKVGYNK
AFGYYLSLPRSKSEQAPDNYIRKQTLVNEERYITPELKERETRILTAQADLNQLEYEIFT
EVRATVAEKAQPIRDVAKAVAAIDVLAGLAEVAVYQGYCRPIMQMEPGLIDIEAGRHPVV
EQSLGAGFFVANDTQLGHDHWHPDLVILTGPNASGKSCYLRQVGLIQLMAQTGSFIPAKT
ATLSICDRIFTRVGAVDDLATGQSTFMVEMNETANILNHATAKSLVLLDEIGRGTATFDG
LAIAWSVAEYLAGEIQARTIFATHYHELNELASLLENVANFQVTVKELPEEIIFLHQVTP
GGADKSYGIEAGRLAGLPSSVITRARQVMAQIEKHSKIAVGLRKGNRGKVMASQAAAEAA
EDQAKQLDIFGF
Download sequence
Identical sequences SgR243 gi|16330413|ref|NP_441141.1| gi|16330413|ref|NP_441141.1| gi|383491207|ref|YP_005408883.1| gi|383325323|ref|YP_005386176.1| 1148.sll1165 gi|383322154|ref|YP_005383007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]