SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330467|ref|NP_441195.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330467|ref|NP_441195.1|
Domain Number 1 Region: 1-161
Classification Level Classification E-value
Superfamily Globin-like 7.25e-82
Family Phycocyanin-like phycobilisome proteins 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330467|ref|NP_441195.1|
Sequence length 161
Comment allophycocyanin b chain [Synechocystis sp. PCC 6803]
Sequence
MQDAITAVINSADVQGKYLDGAAMDKLKSYFASGELRVRAASVISANAATIVKEAVAKSL
LYSDVTRPGGNMYTTRRYAACIRDLDYYLRYATYAMLAGDASILDERVLNGLKETYNSLG
VPISSTVQAIQAIKEVTASLVGADAGKEMGVYLDYICSGLS
Download sequence
Identical sequences A0A0R4I960 L8AFX1 Q01952
001405352|e4po5B1|106.1.1.4|B:1-161 001405353|e4po5D1|106.1.1.4|D:1-161 001405354|e4po5F1|106.1.1.4|F:1-161 001712034|e3jbbB1|106.1.1.4|B:1-161 001712035|e3jbbD1|106.1.1.4|D:1-161 001712036|e3jbbF1|106.1.1.4|F:1-161 001712037|e3jbbH1|106.1.1.4|H:1-161 001712038|e3jbbJ1|106.1.1.4|J:1-161 001712039|e3jbbL1|106.1.1.4|L:1-161 d4po5b_ d4po5d_ d4po5f_ gi|16330467|ref|NP_441195.1| WP_010872504.1.11876 WP_010872504.1.1889 WP_010872504.1.18904 WP_010872504.1.33690 WP_010872504.1.35395 WP_010872504.1.47586 WP_010872504.1.99424 1148.slr1986 gi|16330467|ref|NP_441195.1| gi|383491261|ref|YP_005408937.1| gi|383322208|ref|YP_005383061.1| gi|383325377|ref|YP_005386230.1| 3jbb_B 3jbb_D 3jbb_F 3jbb_H 3jbb_J 3jbb_L 4po5_B 4po5_D 4po5_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]