SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330477|ref|NP_441205.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330477|ref|NP_441205.1|
Domain Number 1 Region: 11-147
Classification Level Classification E-value
Superfamily CheY-like 4.98e-43
Family CheY-related 0.00029
Further Details:      
 
Domain Number 2 Region: 374-535
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.47e-40
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 3 Region: 738-866
Classification Level Classification E-value
Superfamily CheY-like 3.56e-38
Family CheY-related 0.0067
Further Details:      
 
Domain Number 4 Region: 888-1012
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 9.03e-24
Family Sensor-like histidine kinase YojN, C-terminal domain 0.035
Further Details:      
 
Domain Number 5 Region: 305-386
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.35e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 6 Region: 150-277
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000977
Family Heme-binding PAS domain 0.055
Further Details:      
 
Weak hits

Sequence:  gi|16330477|ref|NP_441205.1|
Domain Number - Region: 584-716
Classification Level Classification E-value
Superfamily CheY-like 0.0155
Family CheY-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330477|ref|NP_441205.1|
Sequence length 1014
Comment hybrid sensory kinase [Synechocystis sp. PCC 6803]
Sequence
MSPSQPHPPIATFEPESFLILVVDDVKENIYVISELLEGEGYSTTFVTSGPEALQRVTQA
QPDLILLDLMMPGMDGLEVCDRLKQDPQTRDIPVIFLTASNEKQDLLQAFAKGAVDYVTK
PFSPPELLARVKTHLELKQTRDNLHHTLLEQARTAEALACTSTRLGILVQNMQAGVLMTD
AQGTIVVVNPEFARLFNLGFPADLLLGKNLTAIAPRINGLISHGQGVTHNFLAIESPEPL
LKVELALEDGRFFERDYVPIMLGDSSQGHFWLYRDISQRKQVEMIQGQSLEMERRMRQQL
AEQNQELVAATTAAEAANRSKSEFLATMSHEIRTPMNAIIGMTGLLLDTDLTTQQKYFAQ
TIRNSGETLLTLINDILDFSKIEAGKLDLEVYPFDLGQCLEEALDVVVPSARQKSLTLIR
RFLTPIPPNLQGDVTRLRQILVNLLSNAVKFTEAGQVKVTVEVVDHDAAKGEYQICFAVQ
DTGIGIAPNQQQALFQAFSQGNSSITRRFGGTGLGLAICVRLTALMGGTIWAESNGCVVG
NPPELWQIGQPTIEGSTFYFTVNLTVLPSCAYSVHNLRHSLFIGRSVLVADYDEGRGTRM
RNLLASWRLQAEQITFSSPAKLGEDLKSRLTQKNYGALILHCPYPEGRGKQFTDFDLGKI
TTWAPTEQDIPVLVATDIYLSPGERYSGDKPPVQAWIKSPINPDELENTLVDVLGQTEPP
TLVSTEAISGPLFPYSSSNLTILLAEDNLINQQVAKLLLKKLGYPVDVVNNGQEALSALA
KGDYDVVLMDVEMPEMDGLTATEHIRRSQGRSERPWIIAVTAYSMEGDRERCLASGMNDY
VSKPIRLEALQQALQVAATALQSTSQDRMATVSCVSAFEAKPSPSSPCPEDPAGTTLPPI
DQDIICSLRDLDRENGQLILREIIDIYCQTAPELLQRIKLAIANQDWGNLSSAAHTLGSS
SANLGAVLLAQQAKTLENLTRQRDSRAMDPGHFPTLAASYERVQGELKTMLDRL
Download sequence
Identical sequences L8AFX9 P73828
gi|16330477|ref|NP_441205.1| gi|383325387|ref|YP_005386240.1| gi|16330477|ref|NP_441205.1| WP_010872514.1.11876 WP_010872514.1.1889 WP_010872514.1.18904 WP_010872514.1.33690 WP_010872514.1.35395 WP_010872514.1.47586 WP_010872514.1.99424 gi|383322218|ref|YP_005383071.1| 1148.sll1905 gi|383491271|ref|YP_005408947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]