SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330583|ref|NP_441311.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330583|ref|NP_441311.1|
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Globin-like 2.67e-42
Family Truncated hemoglobin 0.000051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330583|ref|NP_441311.1|
Sequence length 124
Comment cyanoglobin [Synechocystis sp. PCC 6803]
Sequence
MSTLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDK
YDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPAHKRD
VLNQ
Download sequence
Identical sequences L8AJP8 P73925
gi|16330583|ref|NP_441311.1| WP_010872616.1.11876 WP_010872616.1.1889 WP_010872616.1.18904 WP_010872616.1.33690 WP_010872616.1.35395 WP_010872616.1.47586 WP_010872616.1.99424 gi|383322324|ref|YP_005383177.1| gi|16330583|ref|NP_441311.1| gi|383325493|ref|YP_005386346.1| 1s69A gi|383491377|ref|YP_005409053.1| cath|current|1s69A00/2-124 cath|current|1s6aA00/2-124 1s69_A 1s6a_A 1148.slr2097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]