SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330588|ref|NP_441316.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330588|ref|NP_441316.1|
Domain Number 1 Region: 302-503
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.73e-44
Family Nitrogenase iron protein-like 0.00000139
Further Details:      
 
Domain Number 2 Region: 198-276
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 1.96e-17
Family Domain of the SRP/SRP receptor G-proteins 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330588|ref|NP_441316.1|
Sequence length 504
Comment cell division protein FtsY [Synechocystis sp. PCC 6803]
Sequence
MFNWFRRQFGKDNTAPESAPPEGAEVSPELAPEVIQAETESPSEEDSQTTELAAPPPEEP
SSDTANPDDYLQWAKAAYQNIQARKAETVSPPESAAAITVEAGIEETAEEIVVAPESDQA
TATEADLPSPETEITTGPAWLQKSDRLEALKETAVEEATVAGTLTAESMAMDDDFMWSAK
VLAAQGRSAADVSAEEIDWLRKLRQGLSKTRVNLVNQLKSIVGQGPLNEAAVEEIEAILL
QADVGVEATDYIITTLQDKLREEALPPEQAIEFLKEILRSILDRPLLSLPSAEFAPEAEG
LNVWLLTGVNGAGKTTTIGKLAFMAKQSGYDCVIAAADTFRAAAVEQVKVWGERSGVPVI
ANPGQNTDPAAVVYDGISAAQSRNVNLLLVDTAGRLQNKKNLMDELAKIRRIIDKKAPNA
TVESLLVLDATLGQNGLRQAEVFAEAAKLSGVVLTKLDGSAKGGVALAVAQQLNLPIRFI
GAGEGIEDLRPFSSYEFVEALLNG
Download sequence
Identical sequences L8AJQ5 P73930
gi|383491382|ref|YP_005409058.1| gi|383322329|ref|YP_005383182.1| gi|383325498|ref|YP_005386351.1| gi|16330588|ref|NP_441316.1| gi|16330588|ref|NP_441316.1| WP_010872621.1.11876 WP_010872621.1.1889 WP_010872621.1.18904 WP_010872621.1.33690 WP_010872621.1.35395 WP_010872621.1.47586 WP_010872621.1.99424 1148.slr2102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]